I always knew Crazy Bob was, well, "crazy". A crackpot. A nutbasket.
Two burgers short of a Big Mac. Fudged in the head. You know, "cuckoo"
insert ring around the ear gesture. Ever since Crazy Bob turned into
Mark David Chapman and started believing he was me, and signing his
messages with my name, I became convinced this guy was a "lunatic among
lunatics" on Usenet, never mind just RAO!

Then, I didn't understand how a 7phd degreed physicist, audio engineer,
film director, member of SAG and the IEEE, could possibly have the time
to spend every waking moment of every waking day, turning his entire
life into one long mad "soundhaspriority" obsession campaign. Of
course, by the same token, I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham, simply because we both used the phrase
"soundhaspriority" (along with a few thousand other people in the
world... but who's counting?).

Given the fact that I was always able to predict that Robert would jump
on nearly every one of my messages within minutes of me posting it, no
matter what time of day or night, its clear this crazy usenet freak did
not have an actual job (if this crackpot doesn't respond to this
message within 24 hours, call a mortitician. Because it can only mean
he's dead). I guess when you're living in a mental institution as Crazy
Bob must be, time is basically all you have.

I received a letter from his old friend Brian McCarty today (reprinted
below), and what he says about Robert is a lot more credible than
anything Crazy Bob has ever said about him, me or anything, really.
Considering Robert Morein's obsessive agenda to libel and defame an
innocent man (Richard Graham) who has never posted here, it is Crazy
Bob himself who I find personifies "purposeless evil", as he calls it.
So now, the tale of "Crazy Bob Morein" is even clearer. As pathological
liars go, Morein makes Arny look like Mother Teresa. Morein is the
biggest bull****ter I've ever seen in the history of this newsgroup. He
doesn't know the meaning of sincerity or integrity. He does however,
know the meaning of "mad obsessive net stalker and delusional usenet
career troll". (How do you define a "career troll"? 7 years straight of
Crazy Bob obsessively netstalking people, with a promise of at least 7
more, pretty much does it).

THE BACKGROUND on Crazy Bob's Pathology:

Mark David Chapman, for those unaware, is the obsessive madman
responsible for shooting and killing John Lennon, who was a popular
figure who courted not an insignificant amount of controversy in his
public life. Chapman started out liking Lennon and The Beatles, but
later felt Lennon was a "phony", and sold out his ideals. He felt that
by killing Lennon, it would allow him to take Lennon's place.

Morein started out liking me, but now feels that I am a "phony", and a
sell-out. I've also been informed that Morein recently acquired a gun
license, and a handgun. Should I be worried that Crazy Bob will fly to
London to shoot Dr. Richard Graham (who he thinks is me), in order to
become Dr. Graham? Robert took a public vow recently to harass me
wherever I post on Usenet. As we have seen previous to that, Robert has
publicly admitted harassing the real Dr. Graham's colleagues at his
places of work at NHS and Priory, and as I have learned, our Crazy Bob
also harassed and threatened Graham's wife and Graham himself, at
around 3 in the morning, a couple of weeks ago.

It's disturbing enough that Robert thinks he's me and posts under my
identity, but apart from hawking "morphic green sex cream", Crazy Bob
has now taken to signing his messages "Love, SHP". I'm worried that if
Crazy Bob is not physically on his way to London to shoot and kill Dr.
Graham, a completely innocent party to all of this, he's already half
way there 'mentally'. It didn't take much to get Chapman on a plane
from Hawaii to NY, after all. If I ever find out that Crazy Bob Morein
bought a copy of Catcher In The Rye, then I'll be afraid for Dr.
Graham's life and will definitely be taking action against this crazy
crackpot that you've got on your group!

The truth behind Robert Morein's crazy bull****:

-------------------------------------------------------------------

To:
Subject: Nutso Morein
From: "CORAL SEA STUDIOS LOS ANGELES" Add
to Address Book Add Mobile Alert Yahoo! DomainKeys has confirmed that
this message was sent by gmail.com. Learn more
Date: Tue, 25 Apr 2006 11:59:30 +1000
In article ,

" wrote:

Then there's Robert Morein and Brian McCarty. Morein is obsessed with
McCarty and has been for some 7 years I gather. You can't get Morein
alone in a room for 5 minutes without him pouring his freaking heart
out to you about all the real-life hardships he's had to endure about
Brian McCarty. Including McCarty making it impossible for Morein to
openly do business on the web, and having the police raid Morein's
house for dope, and sending Morein's neighbour to the hospital (without
having ever met the guy). Morein was too chicken**** to meet Brian at
Brian's invitation, when Brian was in Morein's town on business. So all
of these very real-life actions were all done from what you call this
"virtual" reality. It may have nothing to do with "real life" to people
like you (or I, of course), but it most definitely does to many RAO
memers here.

You should be aware that the vast bulk of "incidents" cited by Morein
in his email to you (below) are either fictional, or were done by
Morein himself, I don't really know. At least some of the harassment
of others on usenet was done in order to justify his attacks on me, and
the email bombing and other internet harassment techniques he cites
were also done to me at the same time he was doing it to others.
Funnily, he tried his telephone schtick on my closest friends in LA,
who laughed in his face. He soon stopped that tactic. Virtually every
"fact" he posts about me is false, from my height and size to my
location and history.

The "fake endorsement" items he talks about ARE true, and putting them
up on a website kept him occupied for months trying to chase down every
item and "warn" these people. Chick Corea's manager and I are old
friends, and we had a good laugh about it - Morein left literally two
dozen messages at his office, insisting that he needed to personally
discuss the matter with Chick Corea! His grasp of fantasy vs reality is
so poor, you can get him to dance like a chimp with just a little
creative thinking. His major downfall is the internet, which for him
is his only reality, not understanding that it has little reflection on
reality. His letters to the Australian business regulators go into
their Bob Morein "crackpot" file, which I asked them to keep so that
Australian immigration can deny him a visitor's visa should he ever ask
for one. He's on the same kind of "watch" list as all terrorists.

It is notable that his stalking is confined to those overseas, who he
apparently believes won't go to Pennsylvania and kick his ass -
assuming that anyone even cares. I wish he was actually part of the
pro audio community, he'd then be at conferences with me like the AES
in Paris next month, and be easy to hunt down. Stories he tells about
"doing business with proxies" are just hot air - this is a guy that has
accomplished nothing in his life including business, where a modicum of
sanity is generally a prerequisite. His parents should be ashamed of
themselves for not kicking him out of their palatial home long ago.
Perhaps they knew he was incapable of coping in the real world, and
thought they were doing him a favor.


Brian McCarty



From:
"Robert Morein" Add to Address Book
Subject: Amazing FREE Audio Tweak No. 2! For Advanced Audiophiles
To: ". ."


Thanks for the reply. You may be interested to know that just today, McCarty
faxed a complaint to two dental societies, naming them as codefendants in an
imaginary lawsuit, in which he claims that I am somehow using their facilities
to transmit scurrilous messages. The "evidence" cited in the fax are a bunch
of fictitious posts, authored by him, in the nature of racial, ethnic, and
homophobic slurs. He's even trying to pin antisemititism, on me, a jew. This
is the second time he's done this.

Characterisictically, the fax is unsigned, except by printed block letters, as
he is mortally afraid of putting his signature on anything, or conversing by
phone. In the past year, he has also reported me to the Screen Actors Guild,
of which I am a member, with allegations that I'm selling memberships, which
is both illegal and impossible. He put my elderly neighbor in a hospital. He
had the state police come to Ken Drescher's house, on the allegation he was
fencing. The pastor of another victim, and the school district, received
anonymous phone calls asserting the person was a child molester. He found a
guy in Newark, Delaware, who was dealing stereo out of his house, and, while
residing in Australia, successfully pursued a zoning violation complaint that
shut him down.But the thing which started it all on r.a.o. is when he got
someone mad at Bill Watkins, famous as designer of the Watkins bass driver. I
can't remember who the other side was, but I knew Watkins wasn't the kind of
guy that emails viruses. He also tried to get Jim Johnston fired from Lucent
(Bell Labs).

But I digress. McCarty is famous for is the fake endorsement. He has literally
hijacked the names of Chick Corea, an NPR radio host, the French Embassy, K1
Ventures (Singapore's largest venture cap firm), and many non-public figures,
including myself. What you did was very dangerous for me in particular,
because if he saw that I allowed your attribution to go uncontested, I could
end up on another McCarty website. Take a look at
http://www.coralseastudios.com. Currently, he's claiming a deal with Shanghai
Film Studio. Characteristically, he picks a target that has an insignificant
presence on the web. Only one small page on the SFT website is in English; the
rest is entirely for domestic consumption.

It's possible, perhaps even likely, that if I had never had the McCarty
experience, I would have simply laughed. As it stands, I do deal with venture
capital. The subject does come up, and I drag out my McCarty files, and spend
about half an hour, and give them some phone numbers to call.

Can you imagine my horror if I had to spend another half hour explaining yet
something else? Thanks for obliging me.

Another of his nasty tricks is spamming a mailbox to death. Since you have
posted that you believe the forgeries are from McCarty, you are now fair game
for this. It takes just the slightest brush. McCarty also uses the
website About.com in an interesting way. This is the only listserver on
the web that does not require an email confirmation of a subscriptpion. Back a
few years, he would pick his targets on a Friday, and subscribe them to
about 200 About.com listservs, shutting down an email box in a blizzard
of messages. The About staff is unavailable during weekends, so took until
the following Tuesday to get the listbots turned off. Although the FBI
investigation seems to have discouraged this, I still cannot display an email
address.

In fact, I cannot display my name on a website info page. In all my ventures,
I have to work through proxies, simply because of McCarty. Ken Drescher says,
in a singular _expression of hate, that he actually wishes McCarty were dead,
and I agree. This is why I keep pulling his chain. I
know that he is morbidly obese; I know that biological organisms have a
certain limited response to stress, and that when the response is exhausted,
the organism is weakened, or expires. My other friends who have suffered
through this have noted that ignoring him does not work. McCarty is not a
full-featured human being; he seems to personify purposeless evil.

I may have to change this email address shortly, because it's picking up some
spam. If you want me to drop you a line, just post something. And be aware
that McCarty could email you as me. I am a subscriber to Verizon;
fortunately, McCarty cannot authentically forge an email header from a domain
he doesn't have access to.

wrote:
I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt. I
have no idea who you are, but I think it's time you stopped dancing
around with a lot of stuff about putting out hints etc and just told
us. Whatever hints you've given, we didn't get it, so if you clear up
the mystery obviously Robert can't continue to accuse you of being
Richard Graham. Unless of course you want all this nonsense to go on
because you're enjoying it. That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

wrote in message
oups.com...

I always knew Crazy Bob was, well, "crazy". A crackpot. A nutbasket.
Two burgers short of a Big Mac. Fudged in the head. You know, "cuckoo"
insert ring around the ear gesture. Ever since Crazy Bob turned into
Mark David Chapman and started believing he was me, and signing his
messages with my name, I became convinced this guy was a "lunatic among
lunatics" on Usenet, never mind just RAO!

Then, I didn't understand how a 7phd degreed physicist, audio engineer,
film director, member of SAG and the IEEE, could possibly have the time
to spend every waking moment of every waking day, turning his entire
life into one long mad "soundhaspriority" obsession campaign. Of
course, by the same token, I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet,

Well said, Doctor Graham.

Love,
SHP

wrote:
I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt. I
have no idea who you are, but I think it's time you stopped dancing
around with a lot of stuff about putting out hints etc and just told
us. Whatever hints you've given, we didn't get it, so if you clear up
the mystery obviously Robert can't continue to accuse you of being
Richard Graham. Unless of course you want all this nonsense to go on
because you're enjoying it. That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

paul packer wrote:
wrote:

I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,


Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt. I
have no idea who you are, but I think it's time you stopped dancing
around with a lot of stuff about putting out hints etc and just told
us. Whatever hints you've given, we didn't get it, so if you clear up
the mystery obviously Robert can't continue to accuse you of being
Richard Graham. Unless of course you want all this nonsense to go on
because you're enjoying it. That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.



His L shape tweak actually reveals his true identity. If Morein took the
time to look around the related Yahoo group he'd find out exactly who
SHP is.

paul packer wrote:
wrote:

I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt.

There is no evidence to buy. Shippy at one point admitted to being
Richard Graham, before he started vigorusly denying it. That's the
extent of the "evidence": some annonymous troll on the internets
contradicting his own damn self.

Unless of course you want all this nonsense to go on
because you're enjoying it.

Bingo! We've got a winner.

That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

And if he is, so what?

//Walt

"Fella" wrote in message
news
paul packer wrote:
wrote:
[snip]



His L shape tweak actually reveals his true identity. If Morein took the
time to look around the related Yahoo group he'd find out exactly who SHP
is.

Fella, please let me know, and I'll take a look at the group.
Thanks,
Bob Morein

"Walt" wrote in message
...
paul packer wrote:
wrote:

I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt.

There is no evidence to buy. Shippy at one point admitted to being
Richard Graham, before he started vigorusly denying it. That's the extent
of the "evidence": some annonymous troll on the internets contradicting
his own damn self.

Unless of course you want all this nonsense to go on
because you're enjoying it.

Bingo! We've got a winner.

That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

And if he is, so what?

//Walt

One could say, "so what" to all of this. But I feel this person is a sort of
a cancer. He actually hopes to habituate us to his presence, so he can shill
his ****. Read this: http://www.prwatch.org/books/experts.html. It explains
the concept of the "Big Lie", invented by Joseph Goebbels, Hitler's chief
propagandist. He stated that it is easier to make people believe a big lie
than a small one.

The person I believe to be Richard Graham is attempting to habituate us to
the presence of a lying shill on this newsgroup. Once he gets us to swallow
his parasitical self, he figures he can really go to town selling and
shilling snake oil. In my opinion, the reason he keeps bringing up the
denial that he is Richard Graham is because his activities here are in
serious collision with his ethical responsibilities as a medical
professional. He desperately wants to maintain two separate lives, just as
Brian L. McCarty did. So he has to dispatch the suspicion that he is Richard
Graham.

I write screenplays. Part of learning the craft is writing different
characters. To do this successfully, one has to learn how to write in
different "voices". To do this, one has to get inside the head of different
people. I've read Dr. Graham's newsletters. To a writer, they sound very
similar to his posts here. Both individuals have similar styles, mannerisms,
and vocabularies. Both are extremely wordy. As I read both his posts and the
newsletters, I detect the same fingerprints in both. This is the first piece
of evidence.

The second piece of evidence is that Dr. Richard Graham writes in one of his
newsletters that he has chosen the moniker "soundhaspriority". PWB
Electronics sells an embossed aluminum sticker with those words, alleged to
have magical powers to make audio equipment sound better.

The third piece of evidence is a long rant, written in what I judge to be
under the influence of cocaine, which is completely uninhibited, in which
Dr. Graham freely discusses the issues he now wishes to deny. I recognize
the style of that writing as Dr. Graham's.

The fourth piece is that "soundhaspriority" states repeatedly that Richard
Belt is one of the greatest scientists of the 20th century. This person
wants us to believe this. Wanting us to believe this is important only to
someone who has a shared economic interest with PWB Electronics. Richard
Graham does; he writes their newsletter, and let's not be so naive as to
believe he does it for charity.


Fifth: It's also worth considering that a mere troll would not spend 90% of
his posts here denying that he is someone he is not. One of the persons who
was nominated to be the true "soundhaspriority" has a habit of impersonating
living people. For some reason, it is extremely important to
"soundhaspriority" that:
1. He remain anonymous.
2. We not believe that he is Richard Graham.
This is not typical sockpuppet behavior.

The sixth element is not evidential, but it must be considered. Dr. Graham
is an extremely intelligent, albeit unbalanced individual. In terms of sheer
IQ, he considers himself to be more intelligent than any of us. He is
involved in an extremely intricate battle of wits with you. Because of his
intelligence, he can create layer upon layer of lies, intended to confuse
and mislead you. Alan Turing, a seminal British computer scientist, invented
a test of intelligence. According to Turing, the more intelligent entity can
lie and deceive the less intelligent. In my opinion, Dr. Graham is convinced
that by continued deployment of what he considers his superior intelligence,
he can convince you that "soundhaspriority" is someone else. This is the
essence of the Turing Test of artificial intelligence.

The most dangerous thing for any of us is not to acknowledge that there are
people who are more intelligent than us. This goes for anyone. There is
someone more intelligent than you, than me, or practically anyone. High
intelligence is the essential tool of the successful con man. The profession
has attracted many people who aren't smart enough, such as Brian L. McCarty.
But Richard Graham has almost pulled it off. Particularly sophisticated is
the "free tweak" gambit. This is actually how Three Card Monty is played. He
lets you win, before he takes you Big Time.

Don't let Richard Graham take you Big Time.

soundhaspriority wrote:

"Fella" wrote in message
news
paul packer wrote:

wrote:

[snip]


His L shape tweak actually reveals his true identity. If Morein took the
time to look around the related Yahoo group he'd find out exactly who SHP
is.


Fella, please let me know, and I'll take a look at the group.
Thanks,
Bob Morein



Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the PWB
site and found out who SHP was. So in essence you have all the knowledge
you need to get to that information.

I think the conflict, the escalation, the hate between you and SHP has
already gone into a lose-lose situation so I would advise you, from one
human being to another, to not to take it any further and into the real
world once you really do find out who SHP is. I was about to take action
against SHP when, as a sheer coincedence I tried out the pinhole tweak
(I was going to eventually try that tweak in any case since I needed to
be sure of the legitimacy of my position before spilling the conflict
into real life) and lo and behold! the tweak worked overwhelmingly. You
all know the rest ; I had to back off from my position and actually I
have thanked him for his tweaks after that. Now I realise that spilling
this usenet conflict over into real life would have been the silliest
thing to do, much much more sillier then trying out the pinhole tweak
for instance. I see that you are already in a very destructive and
long-winded lose-lose situation with a "McCarty". Why would you need
another one on your back? (And why don't you guys just go your own ways
with this McCarty anyways?)

Is SHP a "shill" for PWB? In my opinion, no. The reasoning: Isn't this
an opinion newsgroup about audio? If someone says good things about a
given amp, cd player, recording label, whatever, is (s)he shilling for
that company now? No. SHP has a right to his opinion about PWB stuff as
much as Jenn has a right to her opinion about the recordings of this or
that label shostakovitch record (for instance), etc, which she freely
expresses and which I thank also *her* for since I have already made use
of a couple of posts.

I would have this suggestion to you: Stop seeing RAO as your turf or
whatever it is you may see it as that leads you to think you should (or
could, for that matter) restrict a given persons right to express this
or that opinion, no matter how obnoxious that set of opinions might be
to you. That kind of position is against the whole logic of usenet.
There is this "institution" called killfile. Just use it against SHP, I
would say. I would suggest the same for SHP against you. This kind of
arrangement would get you guys less stress nand less aggrevation, less
conflict, etc. In this group I have put one "borg-to-the-last-drop" kind
of an entity in my killfile and yes, it's OK.

"Fella" wrote in message
.. .
soundhaspriority wrote:

[snip]
I would have this suggestion to you: Stop seeing RAO as your turf or
whatever it is you may see it as that leads you to think you should (or
could, for that matter) restrict a given persons right to express this or
that opinion, no matter how obnoxious that set of opinions might be to
you. That kind of position is against the whole logic of usenet.

Fella,
I respectfully disagree with you. This thread was started by the
person I believe to be Dr. Richard Graham, not me. If usenet can tolerate an
anonymous shill, then it can certainly tolerate me. I don't believe in
surrendering a public resource to bad guys. To me, the issue is not about
"tweaks." The issue is that I believe this person is trying to cheat the
public, by habituating readers of r.a.o. to an identity that hides his
financial relationship with PWB Electronics. To me, that is a cancer. And
that's the issue, not whether people use, believe in, or discuss tweaks.

I would like to evaluate the information you have mentioned, but I would
appreciate a link.

Bob

Fella said:

Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the PWB
site and found out who SHP was. So in essence you have all the knowledge
you need to get to that information.

I ventured to the Yahoo group and I found somebody posting as "Palm Springs
Gary". He or she is obviously a shill or a roper, but he doesn't reveal his
identity.

Peka, I realize you've been coopted and your free will has been diminished,
but would it be such a hardship for you to explain how you learned what you
believe you know about the RAO troll?






--
A day without Krooger is like a day without arsenic.

soundhaspriority wrote:

"Fella" wrote in message
.. .

soundhaspriority wrote:


[snip]

I would have this suggestion to you: Stop seeing RAO as your turf or
whatever it is you may see it as that leads you to think you should (or
could, for that matter) restrict a given persons right to express this or
that opinion, no matter how obnoxious that set of opinions might be to
you. That kind of position is against the whole logic of usenet.


Fella,
I respectfully disagree with you. This thread was started by the
person I believe to be Dr. Richard Graham, not me.

I am not talking about this particular thread but the whole conflict.


If usenet can tolerate an
anonymous shill, then it can certainly tolerate me.

Usenet is not an entity, just this distributed tool kind of a thing, it
doesn't tolerate to begin with (of course you know this, couldn't
resist). My position is that *you two* don't have to tolerate each other.

I don't believe in
surrendering a public resource to bad guys. To me, the issue is not about
"tweaks." The issue is that I believe this person is trying to cheat the
public, by habituating readers of r.a.o. to an identity that hides his
financial relationship with PWB Electronics.

If SHP really was Richard Graham what you say might have some legitimacy
but since I beleive he is not I see no problem with him talking about
the cream, foil, whatever.

And for the record, I see anonimity as a legitimate choice one has a
right to make, especially in the usenet. I think that these discussion
groups are a ground for the exchange of POV's, info, etc, between given
personalities, characters, etc, and *they* stay the same, *they* make up
the identity, regardless of what the handle claims about the identity.
So a persons first last names are, for me, secondary and even
unnecessary info.


I would like to evaluate the information you have mentioned, but I would
appreciate a link.


Robert, you are going to have to do your own work on that. You know the
link to the PWB site. From that site there is a link to the PWB yahoo
group and in that group you can search them messages and find your dude.
I did not bookmark that particular message anyways...

"George M. Middius" cmndr [underscore] george [at] comcast [dot] net wrote
in message ...



Fella said:

Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the PWB
site and found out who SHP was. So in essence you have all the knowledge
you need to get to that information.

I ventured to the Yahoo group and I found somebody posting as "Palm
Springs
Gary". He or she is obviously a shill or a roper, but he doesn't reveal
his
identity.

Peka, I realize you've been coopted and your free will has been
diminished,
but would it be such a hardship for you to explain how you learned what
you
believe you know about the RAO troll?

I think the problem is that Americans are, as a group, less sophisticated
about the art of deception. England is the home of Kim Philby, Guy Burgess,
Anthony Blunt, and LeCarre novels. As a culture, they have been leagues
ahead of us at humint, and the art of deception. In WWII, they taught the
Americans, but our memories are poor.

In the last century, the best intelligence services have been British and
Russian; the worst, American and German.

George M. Middius wrote:



Fella said:


Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the PWB
site and found out who SHP was. So in essence you have all the knowledge
you need to get to that information.


I ventured to the Yahoo group and I found somebody posting as "Palm Springs
Gary". He or she is obviously a shill or a roper, but he doesn't reveal his
identity.

Peka,

Who the hell is "peka"? Cut it out with this "peka" thing, this is the
second time you are doing this. If I have chosen to call myself "Fella"
around here you should just respect that, Mr. George M. Middius. Thank you.

I realize you've been coopted and your free will has been diminished,

Watch it there dude. I just changed my mind that's all and I would say
that *that's* an expression of free will if anything is.

I just don't think anyone would ever benefit from escalation of this
conflict, that's all.

but would it be such a hardship for you to explain how you learned what you
believe you know about the RAO troll?

First off, he aint no troll. Ok, extremely hard to get along with, yes,
but he is frustrated, more then anything else, and I think that that's
where the agression comes from, not the intent of trolling.

As to the "elementray watson" bit: SHP has revealed in this forum that
the L shape tweak is his invention. In that yahoo group there is this
some other dude (not Graham) talking about the L shape tweak which he
says is his invention. The *very fist* link SHP provided in RAO about
the L shape tweak pictures (not the geocities) was to a yahoo pictures
site which is owned by the same yahoo user handle as the one in the
group proclaiming invention of the L shape tweak. Further google
research using the name derived from this path gets us to the real SHP
almost without a shadow of a doubt, visual tracroutes of the *first*
posts of SHP's NNTP posting host IP's (nowadays they are anonymous)
leads us to more confirmation. Good luck.

"Fella" wrote in message
.. .
soundhaspriority wrote:
[snip]

If SHP really was Richard Graham what you say might have some legitimacy
but since I beleive he is not I see no problem with him talking about the
cream, foil, whatever.

But then the issue is not whether we disagree on ethics; it is about who we
think "soundhaspriority" is. I'm sorry, but I personally find my
investigation more convincing (to me) than yours.

There are many reasons a person may choose to be anonymous on usenet; good,
bad, or indifferent. In this case, I believe that Richard Graham, posting as
"soundhaspriority", is attempting to do a bad thing.

All the best,
Bob

"Fella" wrote in message
.. .
George M. Middius wrote:
[snip]
First off, he aint no troll. Ok, extremely hard to get along with, yes,
but he is frustrated, more then anything else, and I think that that's
where the agression comes from, not the intent of trolling.



As to the "elementray watson" bit: SHP has revealed in this forum that the
L shape tweak is his invention. In that yahoo group there is this some
other dude (not Graham) talking about the L shape tweak which he says is
his invention. The *very fist* link SHP provided in RAO about the L shape
tweak pictures (not the geocities) was to a yahoo pictures site which is
owned by the same yahoo user handle as the one in the group proclaiming
invention of the L shape tweak. Further google research using the name
derived from this path gets us to the real SHP almost without a shadow of
a doubt, visual tracroutes of the *first* posts of SHP's NNTP posting host
IP's (nowadays they are anonymous) leads us to more confirmation. Good
luck.

Fella, this guy is way ahead of you. Have you ever heard of "The Man Who
Never Was" ? http://www.newsoftheodd.com/article1022.html

The Brits love this stuff. And by the way, McCarty does similar things in a
much cruder fashion. Here's an example. Look at the website:
http://www.worldjazz.com. This website is owned by McCarty, but he has
copied the page of another website, http://www.rocketstockpicks.com/. This
is called a "phish scam." He copied the website because he wants to get
Google traffic going to worldjazz.com. After a while, he'll change the page
he copied a little, to toute the penny stock offering of yet another
website, http://www.coralseastudios.com. People will think that
rocketstockpicks is touting his stock, but it's a sham.

Now do a domain lookup (http://www.whois.net) for worldjazz: It gives
something called "Lee Gardens." Now do coralseastudios.com. It gives
something called "Domains by Proxy, Inc." It's all hidden. Look at
http://www.coralseastudios.com/contact.html, the contact page. It shows "LOS
ANGELES OFFICE: (818) 448-2436". But there is no Los Angeles office, just a
voice-over-internet link to his apartment in Cairns.

This is how cons work. They plant false clues all over the place. It is a
hall of mirrors. They confuse; they conquer trust, they get money.

"soundhaspriority"
wrote in message

The person I believe to be Richard Graham is attempting
to habituate us to the presence of a lying shill on this
newsgroup. Once he gets us to swallow his parasitical
self, he figures he can really go to town selling and
shilling snake oil.

Yup, since you reject so much of what's known about audio snake oil, you're
grist for his mill.

"Arny Krueger" wrote in message
...
"soundhaspriority"
wrote in message

The person I believe to be Richard Graham is attempting
to habituate us to the presence of a lying shill on this
newsgroup. Once he gets us to swallow his parasitical
self, he figures he can really go to town selling and
shilling snake oil.

Yup, since you reject so much of what's known about audio snake oil,
you're grist for his mill.
Graham! Two bottles please. Arny's picking up the tab.

Fella wrote:
George M. Middius wrote:



Fella said:


Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the PWB
site and found out who SHP was. So in essence you have all the knowledge
you need to get to that information.


I ventured to the Yahoo group and I found somebody posting as "Palm Springs
Gary". He or she is obviously a shill or a roper, but he doesn't reveal his
identity.

Peka,

Who the hell is "peka"? Cut it out with this "peka" thing, this is the
second time you are doing this. If I have chosen to call myself "Fella"
around here you should just respect that, Mr. George M. Middius. Thank you.

I realize you've been coopted and your free will has been diminished,

Watch it there dude. I just changed my mind that's all and I would say
that *that's* an expression of free will if anything is.

LOL. George is simply working up to calling you a Borg.
He just needs to figure out how one can be a Borg *and* subscribe
to tweaks so patently silly that even 'audiophiles' like him, much
less rational people, find them laughable.

You see, though George claims it's all just about the listening,
and thinks those who raise questions about claims of audible difference
are *pests*, he's really just a *pest* himself. Or at the very
least, verminous.


First off, he aint no troll. Ok, extremely hard to get along with, yes,
but he is frustrated, more then anything else, and I think that that's
where the agression comes from, not the intent of trolling.


If he's not joking, he's borderline loony, if not already well over
the border.


As to the "elementray watson" bit: SHP has revealed in this forum that
the L shape tweak is his invention. In that yahoo group there is this
some other dude (not Graham) talking about the L shape tweak which he
says is his invention. The *very fist* link SHP provided in RAO about
the L shape tweak pictures (not the geocities) was to a yahoo pictures
site which is owned by the same yahoo user handle as the one in the
group proclaiming invention of the L shape tweak. Further google
research using the name derived from this path gets us to the real SHP
almost without a shadow of a doubt, visual tracroutes of the *first*
posts of SHP's NNTP posting host IP's (nowadays they are anonymous)
leads us to more confirmation. Good luck.

The very fist indeed.



___
-S
"Excuse me? What solid proof do you have that I'm insane?" - soundhaspriority

soundhaspriority wrote:
"Fella" wrote in message
.. .

soundhaspriority wrote:

[snip]

If SHP really was Richard Graham what you say might have some legitimacy
but since I beleive he is not I see no problem with him talking about the
cream, foil, whatever.


But then the issue is not whether we disagree on ethics; it is about who we
think "soundhaspriority" is. I'm sorry, but I personally find my
investigation more convincing (to me) than yours.


Of course you have the right to do so. But also you owe it to your own
sense of ethics to thoroughly investigate this issue before you take any
more concrete action against Richard Graham. And Robert, don't be an
"unchangable", really, I mean no disresopect and all, but there are some
people on the usenet that just stick and stick to a position and never
even think of giving an inch, even if the coordinates of the intial
position they refuse the budge an inch from have changed and arm and a
leg in time, as it were. Arny comes to mind... Some of the more
religious fanatics I've slapped around at my time, comes to mind.

I do suggest you go down the same investigative path I went before you
make up your mind to do things irreversible, whatever they may be. And
yes, I am not just talking about the investigation of the SHP identity...

"Steven Sullivan" wrote in message
...
Fella wrote:
George M. Middius wrote:



Fella said:


Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the
PWB
site and found out who SHP was. So in essence you have all the
knowledge
you need to get to that information.


I ventured to the Yahoo group and I found somebody posting as "Palm
Springs
Gary". He or she is obviously a shill or a roper, but he doesn't reveal
his
identity.

Peka,

Who the hell is "peka"? Cut it out with this "peka" thing, this is the
second time you are doing this. If I have chosen to call myself "Fella"
around here you should just respect that, Mr. George M. Middius. Thank
you.

I realize you've been coopted and your free will has been diminished,

Watch it there dude. I just changed my mind that's all and I would say
that *that's* an expression of free will if anything is.

LOL. George is simply working up to calling you a Borg.
He just needs to figure out how one can be a Borg *and* subscribe
to tweaks so patently silly that even 'audiophiles' like him, much
less rational people, find them laughable.

You see, though George claims it's all just about the listening,
and thinks those who raise questions about claims of audible difference
are *pests*, he's really just a *pest* himself. Or at the very
least, verminous.


First off, he aint no troll. Ok, extremely hard to get along with, yes,
but he is frustrated, more then anything else, and I think that that's
where the agression comes from, not the intent of trolling.


If he's not joking, he's borderline loony, if not already well over
the border.

He may be, but not because he wants to sell us "cream". Have you ever
wondered how someone could fall for a Nigerian scam? Everybody knows about
them by now, right? So how could someone be sooo stupid as to give a Mr.
Oladapo Bumpo the keys to your bank account? According to
http://samvak.tripod.com/nigerianscam.html, global annual losses may be as
high as $1.5B, while the annual figure for the U.S. is greater than $100M.

How about ringtones? The annual market for these in the U.S. is projected to
exceed $600M in 2006. So there is no stretch to predict that people might
spend money on a "cream" to improve their enjoyement of music. So hard for
us to believe, but so true. As incredible as it may seem, there may actually
be some people out there, reading this, who are considering the purchase of
the "cream" shilled byDr. Graham.

The problem Graham would like to solve is how to use the technology of the
mind, ie., how to dick with people's heads, in order to market this PWB
Electronics "cream". All the technology of scamming is available to him. All
that remains to be done is to habituate us to his presence. Having seen the
record of scammers worldwide (it IS a good business), it seems entirely
reasonable to him that it should work here. But he forgot the one key
difference: here, everyone has the same communcation tools. People
communicate laterally. A scammer needs to control the channel and isolate
his subject. This is what stands in his way. He has made a big mistake.

See also http://www.419eater.com/html/419faq.htm if you'd like to have some
fun.

soundhaspriority wrote:

"Fella" wrote in message
.. .

George M. Middius wrote:

[snip]

First off, he aint no troll. Ok, extremely hard to get along with, yes,
but he is frustrated, more then anything else, and I think that that's
where the agression comes from, not the intent of trolling.




As to the "elementray watson" bit: SHP has revealed in this forum that the
L shape tweak is his invention. In that yahoo group there is this some
other dude (not Graham) talking about the L shape tweak which he says is
his invention. The *very fist* link SHP provided in RAO about the L shape
tweak pictures (not the geocities) was to a yahoo pictures site which is
owned by the same yahoo user handle as the one in the group proclaiming
invention of the L shape tweak. Further google research using the name
derived from this path gets us to the real SHP almost without a shadow of
a doubt, visual tracroutes of the *first* posts of SHP's NNTP posting host
IP's (nowadays they are anonymous) leads us to more confirmation. Good
luck.


Fella, this guy is way ahead of you. Have you ever heard of "The Man Who
Never Was" ? http://www.newsoftheodd.com/article1022.html

The Brits love this stuff. And by the way, McCarty does similar things in a
much cruder fashion. Here's an example. Look at the website:
http://www.worldjazz.com. This website is owned by McCarty, but he has
copied the page of another website, http://www.rocketstockpicks.com/. This
is called a "phish scam." He copied the website because he wants to get
Google traffic going to worldjazz.com. After a while, he'll change the page
he copied a little, to toute the penny stock offering of yet another
website, http://www.coralseastudios.com. People will think that
rocketstockpicks is touting his stock, but it's a sham.

Now do a domain lookup (http://www.whois.net) for worldjazz: It gives
something called "Lee Gardens." Now do coralseastudios.com. It gives
something called "Domains by Proxy, Inc." It's all hidden. Look at
http://www.coralseastudios.com/contact.html, the contact page. It shows "LOS
ANGELES OFFICE: (818) 448-2436". But there is no Los Angeles office, just a
voice-over-internet link to his apartment in Cairns.

This is how cons work. They plant false clues all over the place. It is a
hall of mirrors. They confuse; they conquer trust, they get money.


This is interesting text and I will look into all this, though they only
deal with McCarty... I suggest humbly that you also look into the
findings reachable (if they are so still) from the path I provide above,
before dismissing them.

Steven Sullivan wrote:
Fella wrote:


The *very fist* link SHP provided in RAO about
the L shape tweak pictures (not the geocities) was to a yahoo pictures
site which is owned by the same yahoo user handle as the one in the
group proclaiming invention of the L shape tweak.

The very fist indeed.


The *very fist*? As in the Stark Fist of Removal?

http://www.subgenius.com/bigfist/fistclutch.html

Ah, now it's *all* coming into focus.


//Walt

Robert said:

The person I believe to be Richard Graham is attempting
to habituate us to the presence of a lying shill on this
newsgroup. Once he gets us to swallow his parasitical
self, he figures he can really go to town selling and
shilling snake oil.

Yup, since you reject so much of what's known about audio snake oil,
you're grist for his mill.

Graham! Two bottles please. Arny's picking up the tab.

Poor Arnii feels ignored. You better tell him we still hold him in the
lowest esteem possible. If he doesn't get his requisite doses of humiliation
on Usenet, he may have to go back to Sunday school so the little kids can
laugh at him while worshipping "God".





--
A day without Krooger is like a day without arsenic.

"Fella" wrote in message
.. .
soundhaspriority wrote:

"Fella" wrote in message
.. .

George M. Middius wrote:

[snip]

First off, he aint no troll. Ok, extremely hard to get along with, yes,
but he is frustrated, more then anything else, and I think that that's
where the agression comes from, not the intent of trolling.




As to the "elementray watson" bit: SHP has revealed in this forum that
the L shape tweak is his invention. In that yahoo group there is this
some other dude (not Graham) talking about the L shape tweak which he
says is his invention. The *very fist* link SHP provided in RAO about the
L shape tweak pictures (not the geocities) was to a yahoo pictures site
which is owned by the same yahoo user handle as the one in the group
proclaiming invention of the L shape tweak. Further google research using
the name derived from this path gets us to the real SHP almost without a
shadow of a doubt, visual tracroutes of the *first* posts of SHP's NNTP
posting host IP's (nowadays they are anonymous) leads us to more
confirmation. Good luck.


Fella, this guy is way ahead of you. Have you ever heard of "The Man Who
Never Was" ? http://www.newsoftheodd.com/article1022.html

The Brits love this stuff. And by the way, McCarty does similar things in
a much cruder fashion. Here's an example. Look at the website:
http://www.worldjazz.com. This website is owned by McCarty, but he has
copied the page of another website, http://www.rocketstockpicks.com/.
This is called a "phish scam." He copied the website because he wants to
get Google traffic going to worldjazz.com. After a while, he'll change
the page he copied a little, to toute the penny stock offering of yet
another website, http://www.coralseastudios.com. People will think that
rocketstockpicks is touting his stock, but it's a sham.

Now do a domain lookup (http://www.whois.net) for worldjazz: It gives
something called "Lee Gardens." Now do coralseastudios.com. It gives
something called "Domains by Proxy, Inc." It's all hidden. Look at
http://www.coralseastudios.com/contact.html, the contact page. It shows
"LOS ANGELES OFFICE: (818) 448-2436". But there is no Los Angeles office,
just a voice-over-internet link to his apartment in Cairns.

This is how cons work. They plant false clues all over the place. It is a
hall of mirrors. They confuse; they conquer trust, they get money.


This is interesting text and I will look into all this, though they only
deal with McCarty... I suggest humbly that you also look into the findings
reachable (if they are so still) from the path I provide above, before
dismissing them.

I'm not dismissing them. I just don't know how to duplicate your search
results.

the evil soundhaspriority wrote:

"Steven Sullivan" wrote in message
...
Fella wrote:
George M. Middius wrote:

LOL. George is simply working up to calling you a Borg.
He just needs to figure out how one can be a Borg *and* subscribe
to tweaks so patently silly that even 'audiophiles' like him, much
less rational people, find them laughable.

You mean "audiofools" like him. And you. Shovels is no more an
audiophile than you are, Sullivan. Having a Rotel amp is not an
automatic membership to that class of hobbyist. He probably inherited
it from his daddy. The idea of "invisible germs magically floating in
the air and landing on patients under surgery only to later infect and
kill them" was also something that was at the time considerided
"patently silly and laughable".

God, if you only knew what an ignorant fool you and Shovels really are,
you'd have some idea of why I'm laughing so hard at the both of you
imbeciles. For the record, I'd like to remind readers that Steven
Sullivan never tried my tweaks, and George Middius claims to have never
tried my tweaks (and lied about having tried them).


You see, though George claims it's all just about the listening,
and thinks those who raise questions about claims of audible difference
are *pests*, he's really just a *pest* himself. Or at the very
least, verminous.


This, I agree with you on. George is just a "pest", he's never proven
himself to be anything but. I don't think he aspires to anything more,
really. But more importantly, this truth makes it evident that George's
entire raison d'etre for plonking his scrawny ass here on RAO every day
of his jobless life, is a farce. A hypocritical farce. For as we have
seen since my arrival, it isn't really "all about the listening" any
longer, with Shovels, is it. He can no longer argue that you or Kruger
are wrong to dismiss audio products without having listened to them,
without looking like a rat-faced hypocrite. You now have some gung-ho
ammunition you can use against Shovels, for as long as his hypocritical
ass remains on this group. Feel free to mock and ridicule him for
having been the first to try my aspirin tweak as well, don't forget.

If I have only accomplished at showing what a lousy stinking Hypocrite
that George Middius is in my time here, I'm satisfied it was time well
spent. ;-)

If he's not joking, he's borderline loony, if not already well over
the border. I don't have to have tried his tweaks to say that, I already
know everything there is to know about audio, science and the universe. Besides,
if they worked, everyone would be pasting animal pics and aspirin on their speakers.
You don't see everyone doing that, do you? Hence, they are as loony as he is.


You've got a point, Sullivan. You've got a point.


He may be, but not because he wants to sell us "cream". Have you ever
wondered how someone could fall for a Nigerian scam? Everybody knows about
them by now, right? So how could someone be sooo stupid as to give a Mr.
Oladapo Bumpo the keys to your bank account? According to
http://samvak.tripod.com/nigerianscam.html, global annual losses may be as
high as $1.5B, while the annual figure for the U.S. is greater than $100M.

Which reminDS me Crazy Bob, I would like to talk to you of a mater of
great urgency... You see, there has been a terrible tragedie in my
femily, where my Uncle HUTUTUTOU MANGOUBOO died at the hands of
Sandanista rebels while bobsledding. He left a great fortune to me and
my femily, but the problem is we are not able to access the funds,
because the government of our banana republic lives in our apt.
building (in the apt. just across from us), and if they are to learn of
our great fortune, they would burn us alive like marshmallows, and spit
on our ashes if they see even a $5 dollar bill falls out of our
pockets. You have been chosen to help us with....

How about ringtones? The annual market for these in the U.S. is projected to
exceed $600M in 2006. So there is no stretch to predict that people might
spend money on a "cream" to improve their enjoyement of music. So hard for
us ignorant morons to believe, but so true. As incredible as it may seem, there may
actually be some people out there, reading this, who are considering the purchase of
the "cream" shilled by Dr. Graham. Me, for example.

You want a vial of "shilling cream", Robert? Well why didn't you shill
so in the first place, instead of shilling through all of these crazy
histrionics? I'll tell you what: I'll shill you a vial of my "cream
electret" for a vial of your "morphic green sex cream". I mean what the
shill, you're not going to be needing any of that shill anways. Are
you, shill?


The problem I would like to solve is how to use the technology of the
mind, ie., how to dick with people's heads, in order to market this PWB
Electronics "cream".

Which reminds me, how IS your "morphic green sex cream" selling here,
shill? Are the numbers in yet?

All the technology of scamming is available to me. All
that remains to be done is to habituate you to my shilling presence. Having seen the
record of scammers worldwide (it IS a good business), it seems entirely
reasonable to me that it should work here. But there is one key
difference: here, everyone has the same communcation tools. People
communicate laterally. A scammer needs to control the channel and isolate
his subject. This is what stands in my way. But I can overcome that.

See also http://www.belt.demon.co.uk if you'd like to have some
fun and buy some fun products.


Richard, we can sure as shill what you are trying to shill here, and
you will not be allowed to continue your shilling shills here, you evil
shiller. Shill off buddy, if you know what's good for you.

paul packer wrote:

wrote:
I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,


GREAT! I start a thread last night about CRAZY BOB MOREIN, I check it
the next day, I find 16 messages and climbing, all about ME again. And
I haven't even had lunch yet. Next I'm sure I'm going to find some more
hypocritical accusations from Crazy Bob, Walt, you or many others,
complaining what an egomaniac I am, how all I do is talk about myself,
and how I'm "raping and pillaging RAO" (I believe those were your exact
words, Paul).

I wonder if anyone here in this thread has ever tried taking a look in
a mirror one time, just to see how pathetic they really are?


Frankly, I've never bought the evidence for you being Richard Graham,

Okay, so far that's:

NOT RICHARD GRAHAM: 1 (Paul)

IS RICHARD GRAHAM: 1 (Robert)

and seeing you posting every day, all day only increased my doubt.

Is that right? Pray tell oh wise Paul Packer, why the hell did you so
stupidly believe I was Dr. Graham in the first place? Because I once
said to Crazy Bob, "You sussed me out!"?

Are you proud of being that stupid and naive, Paul?

I
have no idea who you are, but I think it's time you stopped dancing
around with a lot of stuff about putting out hints etc and just told
us.

I'm not dancing, I'm writing. I'm "soundhaspriority", it's in all my
post headers. And even that doesn't matter, because its just a name. A
rose by another other name, would smell as sweet.

Whatever hints you've given, we didn't get it,

I hate it when you arrogant jackasses keep saying "we", like as though
you got the go-ahead to speak for the entire group. Speak for yourself,
Packer. At least two here did.

so if you clear up
the mystery obviously Robert can't continue to accuse you of being
Richard Graham.

Yeah right! There's another thing you're too dumb to get. First of all,
I have already established in several key threads, including "Message
to the ignorant pigs of RAO", that there is no such thing as "truth" on
this group. No such concept as "reason" or "rationality" that is
universally recognized. All of these things, if they appear, appear by
accident only. Rarely by intention. This means, besides the fact that
most of you are filthy habitual LIARS, what I or anyone says in this
realm doesn't mean anything. Perception is the only truth on RAO.
You're a shining example of that, being the mindless sheep that you
are, Paul.

Why do you think I'm "Richard Graham"? Simple: Robert Morein TOLD you
to think I'm Richard Graham. Did you reject that and decide to think
for yourself? No, you didn't. You did what most here did. Believe
whatever is the perceived truth. Morein, Ludovic and Shovels fought
hard to cement that perceived truth. But they didn't even need to for
your sake. You went "Baaaaa!" and believed it right from the beginning.
At one point, the perceived truth" was that I was May Belt.
Fortunately, that didn't stick for very long. But there were at last
count, over a dozen different other guesses. If I was everyone that you
and the other mindless sheep here convinced themselves I was, I'd be as
mad as Crazy Bob.

Now you say you gradually came to think for yourself and doubt Mad
Morein's word. But then you say if you don't receive a "perceived
truth" from me, then the "absolute truth" shall be whatever you
perceived before. And that's basically how you live your life. So what
if I tell you I'm this or that person, instead of Graham? There's no
reason for you to believe me, since you think I'm lying or deluded
about my tweaks. Like all other sheep here, you don't think. You just
think what makes it easier. (You believe whatever is easiest to
believe).

Secondly: because few if anyone abides by rules of reason and
rationality in this mad pig farm you dare to call a "discussion group",
you're a fool to think Morein can't continue to accuse me of being
Graham. There are several reasons why he can and WILL continue until
the day I leave, even if that is 10 years from now:

1) Like George Middius, Morein is a spineless rat coward, who wages
fierce wars against others that can last years, but only insofar as he
doesn't have to come out from behind his computer and leave his
father's basement. This means he won't ever admit I'm not Graham
because it would make him look like a FOOL to do so. Even though he
doesn't realize he already looks like a FOOL for continuing to make
this ridiculous claim. When I asked him for any evidence whatsoever
that I'm Graham, he continually ignored it. That should tell you right
there how honest Morein is with his beliefs that I'm Graham.

2) Another thing you're too dumb to get: Morein already KNOWS I'm not
Graham. Morein contacted Graham and Graham's colleagues in London (he
admitted as much publicly). Graham told Morein that he does not post to
Usenet. Fella also knows this because he emailed Graham, and Graham
told him the same thing. Morein also read PWB's site, where Graham
apologized to his newsletter readers that he was too busy to post to
PWB's chat group. Crazy Bob knows that if Graham is too busy to post to
PWB's chat room, you can damn well be sure he ain't posting all day
every day to RAO. Then there's the fact that he is a doctor and a
university professor and a family man, and has a very busy life. So Bob
knows that even if the real Dr. Graham wanted to post all day every day
to RAO, he COULDN'T.

3) SO WHY IS Robert Morein CONTINUING TO INSIST THAT I AM RICHARD
GRAHAM, IF HE ALREADY KNOWS SIX DIFFERENT WAYS THAT IT ISN'T TRUE?

Simple: The real purpose behind Crazy Bob Morein trashing an innocent
man, Dr. Richard Graham, is because Morein has a vendetta against me
for revealing what he said to me in an email between us, about having
tried my L-shape tweak. Robert Morein is, as I've said, PURPOSELESS
EVIL.

Robert is a sick fruitcake.

You would have to be, to be obsessed for 7 years with Brian McCarty,
who doesn't even bloody post on this newsgroup any longer, far as I can
tell, except for the odd forgery against Morein, once in a while.

Also, Robert hates me because Robert is a traditional audio engineer
registered with the IEEE. This makes me a #1 target in Crazy Bob's
eyes, because I advocate revolutionary audio ideas that makes the IEEE
look like they've been sleeping the last 50 years. Remember, Robert
KNOWS that my advanced audio ideas are valid (at least in the case of
the L-shape), but he doesn't want that known. This is why he lambasted
Sander and Fella for merely having tried my tweaks. He tried to make
them think they were fools, fooling themselves. This is why he goes
nuts every time that I post Belt's website address (ie.
http://belt.demon.co.uk) and cries "SHILL! THEIF! CRIMINAL! CRACK
ADDICT! MURDERER!" as loudly as possible in the hopes of anyone hearing
and believing him. Despite the fact that he was seen here shilling
PWB's products!

So he is trying to defame the good reputation of Dr. Graham, even
though he knows I'm not him, but simply because as the newsletter
editor, Graham is associated with PWB. Anyone associated with PWB is
fair game to Mad Morein, because it threatens everything he stands for,
and even his position with the IEEE (this is why Robert tried to
threaten me if I didn't retract what I revealed about him trying the
L-shape). I have of course since, retracted my retraction. Mad Morein
-did- try the L-shape, and I posted the email in which he admitted it.

Unless of course you want all this nonsense to go on
because you're enjoying it.

What a stupid comment. Thank you for confirming just how stupid you
are. If I wasn't enjoying the nonsense going on here, why in the blue
bloody hell would I be here, genius?

Another possibility
is that you are Richard Graham after all and can't prove otherwise.

Another possibility is that YOU are Richard Graham and can't prove
otherwise. Another possibility is Crazy Bob Morein is Richard Gere, and
can't prove otherwise. Another possibility is that Shovels is Pee Wee
Herman, and can't prove otherwise. Another possibility is that everyone
on the group is Ethel Merman, and can't prove otherwise.
Jeez, you're really not a very profound thinker, are you? I feel like
slapping you a couple of times in the head, grabbing you by the
shoulders and yelling "THINK, YOU IDIOT! **THINK**!".

Walt wrote:
paul packer wrote:
wrote:

I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt.

There is no evidence to buy. Shippy at one point admitted to being
Richard Graham, before he started vigorusly denying it. That's the
extent of the "evidence": some annonymous troll on the internets
contradicting his own damn self.

That's not the way it went, but... .why quibble over facts? Facts never
made a dent in any of your bigoted, racist opinions. I just want to
record your vote. If I understand correctly, you're voting -against-
your friend Mad Morein on the issue of me being Dr. Richard Graham. If
I'm mistaken, do feel free to correct me. The tally so far is:

NOT RICHARD GRAHAM: 2 (Paul, Walt)

IS RICHARD GRAHAM: 1 (Robert)


Bingo! We've got a winner.

(Sorry Crazy Bob.... Looks like you're still going to have to take your
meds like a big boy...)

That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

And if he is, so what?

Bingo, again!

It wouldn't matter to me if you're George Bush Sr., which is as much a
possibility as me being Richard Graham. You'd still be a dumb ignorant
asshole to me, Walt. And an anonymous netstalking troll.

the mad, the evil, the bombastic, the Mark David Chapman of RAO, the
one and only imposter of soundhaspriority, aka Crazy Bob Morein, wrote
a frothing mad paranoid lunatic diatribe that looked like this:

"Walt" wrote in message
...
paul packer wrote:
wrote:

I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt.

There is no evidence to buy. Shippy at one point admitted to being
Richard Graham, before he started vigorusly denying it. That's the extent
of the "evidence": some annonymous troll on the internets contradicting
his own damn self.

Unless of course you want all this nonsense to go on
because you're enjoying it.

Bingo! We've got a winner.

That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

And if he is, so what?

//Walt


One cudd say, "so what" t' all of dis, GEEEHEEHEEE.But I feel dis pehson is a sort of
a casser. He ackual hopes t' habituate us t' his presess, so he can shill
his ****. Gawlly!Read dis: http://www.prwatch.org/books/expehts.html. It explains
the, errr, cosspt of de "Big Lie", inbentid by Dgoseph Goebbels, duuhhhh, Hitler's chief
propagandist. He statid dat it is easieh t' make peoble beliebe a big lie
dan a small one.

De pehson I beliebe t' be Richard Graham is attemptigg t' habituate us t'
de presess of a lyigg shill on dis newsgroup. Gawlly!Oss he gets us t' swallow
his parasitical self, uh uh uh uh uh, he figers he can real go t' town selligg 'n
shilligg snake oil. In my opinion, de reason he keeps briggigg up de
denial dat he is Richard Graham is cuz his ackibities hehe are in
sehious collishun wid his edical reponsibiltibies as a medical
professhunal. He despehate want t' maitain two seprit libes, duuhhhh, dgust as
Brian L. Gawlly!McCarty did. So he has t' dispatch the, ERRRR, suspicion dat he is Richard Graham.

I write screenplays. Part of learnigg the, errr, craff is writigg diffehent
charackehs. Lee me lone! T' do dis successful, one has t' learn duh, how t' write in
diffehent "boices". DOIHH!T' do dis, duuhhhh, one has t' get inside de gord of diffehent
peoble. I'be read Dr. Graham's newslettehs. T' a writeh, dey sound behy
similar t' his posts hehe. Bod indibiduals habe similar styles, duuhhhh, mannehisms, duuhhhh,
'n bocablaries. Duh.Bod are extreme wordy. Gawlly!As I read bod his posts 'n de
newslettehs, duuhhhh, I deteck the, ERRRR, same figgehprints in bod. Dis is the, uh uh uh, first piece
of ebidess.

De seconb piece of ebidess dat Dr. Richard Graham writes in one of his
newslettehs dat he has chosen de monikeh "soundhaspriority". Duh.PWB
Eleckronics sells an embossid aluminum stickeh wid dose words, duuhhhh, allegid to
habe magical powebuhrs t' make audio ekipmin sound betteh.

De dird piece of ebidess is a long rant, uh, wrote in what I dguje t' be
undeh de influess of cocaine, uh uh uh, which is c'plete unhibited, uh uh uh uh, in which Dr. Graham free discusses de issues he now wishes t' deny. I recognize
the, ERRRR, style of dat writigg as Dr. Graham's.

De fourd piece dat "soundhaspriority" states repeated dat Richard
Belt is one of de greatest scientists of de 20d century. Dis pehson
want us t' beliebe dis. Gawlly!Wantigg us t' beliebe dis is iportant on to
someone who has a sharid economic innerest wid PWB Eleckronics. Richard
Graham does; he writes deir newsletteh, 'n let's not be so naibe as t'
beliebe he does it f' charity.

Fiffh: It's also word considehigg dat a mehe troll wudd not spend 90% of
his posts hehe denyigg dat he is someone he is not. Lee me lone!One of de pehsons who was nominatid to be the, duh uhh, true "soundhaspriority" has a habit of ipehsonatigg
libigg peoble. F' some reason, it is extreme iportant t'
"soundhaspriority" dat:
1. He remain anonymous.
2. Webuh not beliebe dat he is Richard Graham.
Dis is not typical sockpuppet behabior.

De sixd elemin is not ebidenshul, but it must be considehed. Dr. Graham
is an extreme intelligent, uh, albeit unbalassd indibidual. GEE danks.In tehms of sheeh
IQ, he considehs himself t' be more intelligent dan any of us, GEEEHEEHEEE.He is
inbolbid in an extreme intricate battle of wits wid you. Cuz of his
smehts, he can crate layeh upon layeh of lies, duuhhhh, intendid to confuse
'n mislead you. Alan Turigg, a seminal British c'pootr scientist, uh, inbentid
a test of smehts. Accordigg t' Turigg, de more intelligent entity can
lie 'n deceibe de less intelligent. In my opinion, Dr. Duh.Graham is conbissd
dat by continuid deploymin of what he considehs his supehior smehts,
he can conbiss you dat "soundhaspriority" is someone else. Lee me lone!Dis is de
essess of de Turigg Test of artificial smehts.

De most dangehous digg f' any of us is not t' acsmehts dat dehe are
peoble who are more intelligent dan us. Lee me lone!Dis goes f' anyone. Um uh.Dehe is someone more intelligent dan you, dan me, uh uh uh, or prackical anyone. High
smehts is the, uh, essenshul tool of the, ERRRR, successful con man. De professhun
has attrackid many peoble who aren't smehts enough, such as Brian L. McCarty.
But Richard Graham has almost pullid it off. Particular sophisticatid is
de "free twebuhak" gambit. Dis is ackual how Dree Card Monty is played. He
lets you win, bef'e he takes you Bik Tyme.

Duuhhhh, Don't let Richard Graham, errr duh, tayke you Bik Tyme.


Sorry Goofy, I didn't understand much of your mad evil tirade about me,
but I thought I saw the word "Hitler" in there. And so, for comparing
me to "Hitler", I invoke upon thee, Godwin's Law
(http://en.wikipedia.org/wiki/Godwin's_law)

Which means I now decla I WON.

Thank you, you may carry on being a mad fool.

soundhaspriority wrote:

One could say, "so what" to all of this. But I feel this person is a sort of
a cancer. He actually hopes to habituate us to his presence, so he can shill
his ****.

Quite frankly, I've never heard of anything smoke quite so crazy in
all my life. Marlboro

Read this: http://www.belt.demon.co.uk. It explains
the concept of the "Big Lie", invented by Joseph Goebbels, Hitler's chief
propagandist. He stated that it is easier to make people believe a big lie
than a small one.

I didn't see anything about Hitler, the obvious inspiration you have
had for this hate campaign you've waged on RAO against an innocent
party, Dr. Graham. Are you sure you have the address correct? I did
however find some real interesting audio products on your site, so it
wasn't a total waste of time. Like reading your mad drivel normally is.
I even found that "morphic green cream" you were shilling a few days
ago. Did you do that on purpose, to deliberately shill some of your
crazy-sounding audio products, like "morphic green cream"?

The person I believe to be Richard Graham is attempting to alert us to
the presence of a lying evil madman on this newsgroup.

Correct. The person I believe to be Robert Morein who believes himself
to be "soundhaspriority" who believes is Richard Graham, is in fact an
evil, lying troll with an agenda to cause malice and harm to innocent
people (and their wives) who are not part of this newsgroup. In my
opinion, you keep bringing up the denial that Graham doesn't post on
this newsgroup and is too busy to ever do so, because my activities
here are in serious collision with your IEEE agenda to sell electronic
equipment so that people can spend a lot more money upgrading their
equipment on a regular basis, then the alternative of spending a lot
-less- at places like http://www.belt.demon.co.uk, by improving what
they already have to a greater degree than upgrading would allow, for
the same cost. At the same time, to cover your bases, you shill
"morphic green sex cream" on this group. Funny, that. Looks like you so
desperately wants to maintain two separate lives, to feed off the teet
of conventional audio manufacturers, while stuffing your coffers with
the dollars of unconventional audio products.

I write screenplays.

Pffffffffffff!!!!!!! I saw that piece of **** you call a "screenplay"
at the Teluride Festival. What what was that shlock called.... "Road
Rage"? You're as much a screenwriter as you are an audio engineer.
Written many screenplays lately, during the two minutes you have in the
day when you're NOT obsessively writing about me on RAO?

Didn't think so. LOL!

The second piece of evidence is that Dr. Richard Graham writes in one of his
newsletters that he has chosen the moniker "soundhaspriority".

What a brilliant web researcher you are. No wonder you didn't know a
damn thing about what you were talking about with quantum mechanics and
morphogenetic resonance, when you tried to "debunk" the theories a
while back. What your "in-depth" research overlooked is that Dr.
Richard Graham is simply one of many PWB customers, no more, no less
(apart from editing the PWB Newsletter, which is independent of PWB).
Hundreds of other PWB customers like Graham chose the same moniker to
apply to objects in their audio components and elsewhere. That's
because the moniker was devised by BELT, you grumbling imbecile. Not
Graham.

PWB Electronics sells an embossed aluminum sticker with those words, alleged to
have magical powers to make audio equipment sound better.

PWB Electronics does not sell ANYTHING "alleged to have magical powers
to make audio equipment sound better". As a matter of fact, PWB does
not sell ANYTHING that makes audio equipment sound better, whether by
magic or otherwise, you seething imbecile. This shows you do not have
even the most -basic- idea of what you're talking about, when you talk
about PWB, its theories, its customers or its staff.

And everything PWB does research and market has a scientific basis
behind it, regardless of whether you are too clueless to fully
comprehend it.

The third piece of evidence is a long rant, written in what I judge to be
under the influence of cocaine, which is completely uninhibited

I submit your post here as that "third piece of evidence", you evil
nutjob.

Dr. Graham freely discusses the issues he now wishes to deny. I recognize
the style of that writing as Dr. Graham's.

Ths coming from an evil madman who posts as "soundhaspriority" and
signs his messages, "Love, SHP". You don't even recognize your own
neurotic insanity!

The fourth piece is that "soundhaspriority" states repeatedly that Richard
Belt is one of the greatest scientists of the 20th century. This person
wants us to believe this. Wanting us to believe this is important only to
someone who has a shared economic interest with PWB Electronics.

THAT IS ANOTHER CRAZY LIE!! When I have ever stated "Richard Belt is
one of the greatest scientists of the 20th century"?? And by the way,
who the hell is "Richard Belt"? Is EVERYONE named "Richard" to you, you
crazy MF?..

SHP: Q. QUICK! Who's your president?

Crazy Bob: A. "Richard Bush"

SHP: Bzzzzzzzt! WRRRRRONG!

Okay Richard Morein, for the double round now, what's the name of the
president that freed the slaves?

Crazy Bob: A. "I know that one! That guy with the stovepipe hat!
Richard Lincoln!"


SHP: Bzzzzzzzt! WRRRRRONG AGAIN!


Crazy Bob: "Are you sure? Because I'm not mistaken about this."

SHP: "I can only go by what it says on my cue cards, Richard. You'll
have to accept the official results. Next question is for the ultimate
grand prize, so please, listen up..."

Q. "In 1957, Jerry Lewis partnered up with this martini swilling
swinger, who played the straight man to Mr. Lewis' zany goof-up
character, and together, they became one of Hollywood's most famous
comedy duo's. What is the name of both parties involved in this duo?"

Crazy Bob: "This one I know! My father Sylvan used to make me watch
them all the time! It's the comedy duo of Richard Lewis and Richard
Martin!".

SHP: Ding! You are correct sir! Please come up and collect your prize
of one thrilling smash about the head with a sack of brass doorknobs by
our very lovely host, Mrs. Grunchstummik.


(n.b. to group: Yeah, I know the right answer is "Jerry Lewis & Dean
Martin". I didn't have the heart to watch Crazy Bob get it wrong
again).



Richard
Graham does; he writes their newsletter, and let's not be so naive as to
believe he does it for charity.

Let's not, because he doesn't. Unlike you, he does it because he's an
audiophile who believes in audio, and Belt's products, and a lot of
other things. Like me. He does not believe, however, in spending the
result of $30,000 and 7 phds of education running around like a mad
crazy chicken on Usenet for one's entire pathetic wasted life,
maliciously ranting and raving about the evils of of people who come on
your newsgroup and share free tweaks with people (that have helped RAO
participants improve their audio system for free). Simply because the
tweaks run counter to the politics of the IEEE and the billion dollar
electronics industry. Who's dick you suck on to support yourself, even
while you're living in your father's home at the age of 55.

Let's not be so naive as to think "Crazy Bob" is running this malicious
campaign against PWB or its newsletter editor (who has said he does not
have the time to post anywhere), because he wants to "save the poor
innocent mindless sheep of RAO" from being "taken in by the big bad
evil wolf who will brainwash them into buying morphic green sex cream
when their guard is let down!". Especially when Crazy Bob is doing this
by pecularly, posting under what he calls "Richard Graham's moniker",
signing his messages "SHP" and hawking "morphic green cream" on the
group. Along with dangerous toxic sprays designed to improve your audio
sound.

Fifth: It's also worth considering that a mere troll would not spend 90% of
his posts here denying that he is someone he is not.

Unless of course he isn't a troll, and wasn't that person you claim he
is. Thank you for proving yourself wrong on both counts, so
eloquently....

One of the persons who
was nominated to be the true "soundhaspriority" has a habit of impersonating
living people.

Although purely by accident, this does appear to be true. "Crazy Bob"
nominated himself to be the "true soundhaspriority", much as Crazy Mark
David Chapman nominated himself to be the "true John Lennon". Crazy
Bob, who signs his letters "Love, SHP", whom he says is Richard Graham,
obviously has a habit of impersonating people.

For some reason, it is extremely important to
"soundhaspriority" that:
1. He remain anonymous.
2. We not believe that he is Richard Graham.
This is not typical sockpuppet behavior.

Because I'm not Richard Graham, and unlike you, I'm not a "sockpuppet".
Thank you again for proving yourself wrong on both counts, so
eloquently....

The sixth element is not evidential, but it must be considered. Dr. Graham
is an extremely intelligent,

I think he already knows that.

albeit unbalanced individual.

I think he already knows that. About you. I'd say you calling his wife
at three in the morning, threatening her and her husband, and harassing
his colleagues at his place of work in London was evidence enough that
you are an "unbalanced individual". Mind you, all he had to do to be
convinced that you are an unbalanced individual is to a Google search
on you, and find literally THOUSANDS of messages from people who
confirm that you are an unbalanced individual. Including some of the
regulars on this group. You spending 7 years on evil hate campaigns
like this one against your perceived "enemies" is pretty convincing
evidence of how "balanced" you are.

In terms of sheer
IQ, he considers himself to be more intelligent than any of us.

More lying bull****. Not Graham nor anyone else that I recall ever said
that.

He is
involved in an extremely intricate battle of wits with you.


Because of his
intelligence, he can create layer upon layer of lies, intended to confuse
and mislead you.

Faulty logic. I've demonstrated many times in my time here that you're
a hopeless imbecile. Yes, to my own surprise, despite your 7 phd's and
despite your furtive belief that you're a really clever little
malicious troll, and can outwit all your opponents with endless reams
of bull****. And yet... you have no problem creating layer upon layer
of lies, intended to confuse and mislead the netizens of RAO (example:
the lie that you are "soundhaspriority", the lie that
"soundhaspriority" is "Richard Graham", the lie that PWB's products are
"snake oil" when you've never tried them and don't know anything about
them, all the while you are seen shilling "morphic green cream" and
other PWB products).

On the other hand, me, I'm a lot more honest and open with the good
people of RAO. I just call them "ignorant pigs". So at least they know
what I'm about about, where I'm coming from and what I think of them.
It's evil malicious trolls like YOU they have to be careful to watch
out for. Because YOU think you're smarter than everyone here, simply
because you're more educated than everyone here. That's why you're
having everyone on RAO for a laugh with this "soundhaspriority is
Richard Graham and a shill" crap, at their expense. I don't hide my
contempt for the imbeciles that inhabit RAO. I come straight out and
tell them that I'm laughing in their stupid faces, whenever I am. You
however, it amuses you to play head games with them and laugh at them
-behind- their stupid faces.

I guess we're not so different after all, soundhaspriority.

Alan Turing, a seminal British computer scientist, invented
a test of intelligence. According to Turing, the more intelligent entity can
lie and deceive the less intelligent.

W@W. I can only imagine the tens of thousands of dollars of research
poured into this study to come up with THAT brilliant observation. Like
you, Turing must have been laughing at all his colleagues and the
people who funded his study, during the entire time he was doing his
research.

The most dangerous thing for any of us is not to acknowledge that there are
people who are more intelligent than us.

This I agree with, but for different reasons than you, since you are
after all, a ranting mental case. It isn't "dangerous" but it -is-
arrogant of us not to acknowledge that there are people who are more
intelligent than us. Few people want to admit that, and prefer to think
of themselves as equals or superiors. Robert Morein obviously does
think of himself as "superior" to the rest of the group, he told me as
much in an email once. I have no problem acknowledging, if not
worshipping, those more intelligent than I. I admit they don't come
along as often as I'd like, but nevertheless, I try to learn a lot from
them. Seems that most, once they finished their formal education, don't
have much of a curiousity to learn any longer. The neural pathways may
get cut off leaving them little choice, in the end. This is part of the
reason people fearfully stay away from my tweaks. They know that by
approaching them, it would necessitate learning something new about
audio. God forbid! Can't have that...

;-)

High intelligence is the essential tool of the successful con man.

Guess that explains why you never sold any of your "Morphic green sex
cream" or "DHM Spray" on this group.

This is actually how Three Card Monty is played. He
lets you win, before he takes you Big Time.

Okay...
pickacardanycarddontmatterwhichcardpickanycardanyc ardwilldojustonecardmaamanycardanycardpickthelucky cardgettheluckydollarjustpickacardnowyouseeemnowyo udontgottacardpickacardringaroundtherosieapocketfu llofposiehushahushaweallfall...
sorry, you lose!

Don't let Richard Graham take you Big Time.

I agree. But "soundhaspriority"? Hey, you can trust him! He loves his
mother!

paul packer wrote:
wrote:
I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,

Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt. I
have no idea who you are, but I think it's time you stopped dancing
around with a lot of stuff about putting out hints etc and just told
us. Whatever hints you've given, we didn't get it, so if you clear up
the mystery obviously Robert can't continue to accuse you of being
Richard Graham. Unless of course you want all this nonsense to go on
because you're enjoying it. That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.

Uh, I heard you the first time, Paul

Fella wrote:
paul packer wrote:
wrote:

I couldn't understand how Robert and others
can believe that Dr. Richard Graham, a London psychiatrist for
adolescent behaviour, family man and mathematics professor, who has
announced that he's too busy to edit his own newsletters and does not
post on usenet, could possibly be me, posting all these messages on RAO
every day. But apparently, Robert and Ludovic Mirabel and Shovels and
Walt and Paul Packer and Steven Sullivan and Powell can all somehow
understand this, and find Crazy Bob quite credible in his assumption
that I must be Graham,


Frankly, I've never bought the evidence for you being Richard Graham,
and seeing you posting every day, all day only increased my doubt. I
have no idea who you are, but I think it's time you stopped dancing
around with a lot of stuff about putting out hints etc and just told
us. Whatever hints you've given, we didn't get it, so if you clear up
the mystery obviously Robert can't continue to accuse you of being
Richard Graham. Unless of course you want all this nonsense to go on
because you're enjoying it. That's a possibility. Another possibility
is that you are Richard Graham after all and can't prove otherwise.



His L shape tweak actually reveals his true identity. If Morein took the
time to look around the related Yahoo group he'd find out exactly who
SHP is.

Bingo! I think we have a winner!

Fella wrote:

soundhaspriority wrote:

"Fella" wrote in message
news
paul packer wrote:

wrote:

[snip]


His L shape tweak actually reveals his true identity. If Morein took the
time to look around the related Yahoo group he'd find out exactly who SHP
is.


Fella, please let me know, and I'll take a look at the group.
Thanks,
Bob Morein



Robert, when I was in conflict with SHP and was meaning to carry the
conflict over to real life I went to the Yahoo group linked from the PWB
site and found out who SHP was. So in essence you have all the knowledge
you need to get to that information.

Morein always had that knowledge that took you no time to find. He did
go to the PWB site, but he stopped there at Richard Graham and looked
no further, simply because he saw Graham mention the Beltist phrase
"soundhaspriority". Obviously, Crazy Bob doesn't think very hard about
anything, such as the fact that Dr. Graham doesn't know anything about
the L-shape, and never once talked about it in his newsletters or
advocated it on the chat forum. Clearly, this evil arrogant egomaniacal
******* who shoves his 7 phd's in our faces every day (from "Drexel
University" of all things) is not as smart as he thinks he is.

I think the conflict, the escalation, the hate between you and SHP has
already gone into a lose-lose situation so I would advise you, from one
human being to another, to not to take it any further and into the real
world once you really do find out who SHP is.

He already took it into the "real world" by calling Dr. Graham's home
at 3 am, threatening his wife, and harassing his medical colleagues at
NHS and Priory. That's why I want the MF stopped, even if I have to
slap a libel suit on him myself, on behalf of Graham. Since I'm not
Graham, it's not a "lose" situation for me. It's only a "lose"
situation for Morein, since he's the one who appears to be sensitive to
having his reputation damaged (consider the fact that Mad Morein sent
me a threat of litigation by email, simply on account of his reputation
with the IEEE being damanged because I mentioned that he tried my
L-shape tweak!).

Now I realise that spilling
this usenet conflict over into real life would have been the silliest
thing to do, much much more sillier then trying out the pinhole tweak
for instance.

Indeed! VERY silly. This is precisely why I was laughing so hard at
Morein when he emailed me threats from his lawyer, wherein he
threatened that if I didn't officially retract my public statement that
he tried my L-shape tweak, he would go ahead and sue Dr. Richard
Graham!
Can you imagine him trying to prove in court that yes, Dr. Richard
Graham, editor of pwb's newsletters, is the same guy on RAO who
admitted that Morein tried the L-shape tweak on the basis that Graham
wrote the phrase "soundhaspriority" in one of his newsletters, and that
Morein is a "screenplay writer" and can "get into the mind of a writer"
and therefore knows "exactly who is writing what under which alias"
because Morein is such a brilliant "writer" and "thinker". LOL!

I want Mad Morein to realize what a fool he is for maintaining the
belief that I'm Graham despite the overwhelming evidence to the
contrary, and failing that, everyone else realize what a fool Morein is
for believing I'm Graham.

I see that you are already in a very destructive and
long-winded lose-lose situation with a "McCarty". Why would you need
another one on your back? (And why don't you guys just go your own ways
with this McCarty anyways?)

I don't pretend to know exactly what Morein's beef is with McCarty.
Maybe Morein was a Bose salesman and McCarty was selling Bose speakers
on the block at the corner of Morein's "turf". THen the two started
bashing each other with their pimp canes, until Morein got hit too
many times and fled on his electric wheelchair, with one of his Bose
speakers trailing along the ground behind him, held only by its wire.
Nor do I want to know what sort of madness drives Crazy Bob to obsess
about McCarty to the tune of thousands of messages over 7 years, whom
no one else here seems to care about. I'm sure there isn't a rational
reason for why Morein is obsessed with McCarty, since there isn't a
rational reason for why Mad Morein is obsessed with me, or Dr. Graham,
for that matter. All I know is that Morein has done JACK SQUAT to Brian
in 7 years of trolling him on Usenet, and harassing Brian's colleagues
at work. McCarty is alive and well, still has his websites, and as far
as I can tell, is doing fine business. However, it appears that it is
Morein and his friends and neighbours that have taken the hardest hits
in the Morein-McCarty wars. You should have seen the way Morein was
writing to me about McCarty. Not just as a man possessed, but a man in
total fear of McCarty (Morein even talked about having to hide his web
businesses under proxies out of fear of McCarty). That does NOT sound
like a confident "winner" to me.

Make no mistake, Robert Morein can do absolutely nothing to harm me in
any way, shape or form. However, he is very much a self-destructive,
obsessive neurotic nutjob. He can do lots to harm himself, and it looks
like he very much has. Sure I goad him on.... I like to think that I
"inspire" him to pursue his attacks against me, that like his friend
Shovels Middius, I give him a temporary "purpose in life". But you know
me... I *like* ****ing with arrogant fools like Morein and Middius. For
the same reasons that Groucho Marx used to make fun of the Bourgeois
elite. These arrogant fools take themselves way too seriously.


Is SHP a "shill" for PWB? In my opinion, no. The reasoning: Isn't this
an opinion newsgroup about audio? If someone says good things about a
given amp, cd player, recording label, whatever, is (s)he shilling for
that company now? No. SHP has a right to his opinion about PWB stuff as
much as Jenn has a right to her opinion about the recordings of this or
that label shostakovitch record (for instance), etc, which she freely
expresses and which I thank also *her* for since I have already made use
of a couple of posts.

Bingo again! Nice to see that finally, someone gets it! Although I
haven't expressed it yet, that's exacty my reasoning for saying good
things about Belt's products, just as I have said good things about his
tweaks, and just as I have said good things about Connoisseur's
products, or Sonic Impact's products, or bad things about Rega's
products! It's a freaking audio opinion group, boys! When in the hell
did everyone lose sight of that fact here??!

It's obvious that I'm being held to a double standard by Crazy Bob
Morein, Packer, Walt, Westpase, Ludovic, etc. etc. All of whom,
including Morein and his "Near" speakers, have no problem with the idea
of advocating whatever audio products or companies they like or dislike
on this group. But let me advocate productst that THEY don't advocate
and WHOAH! SHP IS SHILLING ON RAO! HANG HIM BY THE NECK UNTIL HE OR SHE
IS DEAD!!!!!!

This is why I describe many of the people here as "audio racists". It's
a form of bigotry not unlike what drives ugly racism. By the same
reasnoning, Blacks in the rural south weren't allowed to vote because
their "opinions" didn't count. Robert Morein and his allies are trying
to tell me and the rest of the group that MY opinions about audio
"don't count" and are "not allowed". Then this mad evil troll has the
nerve to compare ME to Hitler, when he's the one acting like a fascist
dictator on a supposedly open and democratic group, telling everyone
that my opinions on audio should not be allowed!!

I would have this suggestion to you: Stop seeing RAO as your turf or
whatever it is you may see it as that leads you to think you should (or
could, for that matter) restrict a given persons right to express this
or that opinion, no matter how obnoxious that set of opinions might be
to you. That kind of position is against the whole logic of usenet.

Exactly! It's against the entire notion of free speech, which is WHAT
USENET WAS INVENTED FOR!!

We can see how my beliefs are such an enormous threat to Robert Morein
and his secret IEEE organization, in the way he has started this
campaign to quell my rights to free speech and supress my audio
opinions *****exactly when you and Sander started finding out that I'm
not so "insane" after all, and that the tweaks are actually legit!****

He certainly did not start doing this when I came on the group, nor did
he do this after he started beleiving I was Richard Graham. Any wonder
why?!

There is this "institution" called killfile. Just use it against SHP, I
would say. I would suggest the same for SHP against you.

I agree, if Morein doesn't like my posts, he can just killfile me. I
use Google for news and I like using it, but it has no killfile
feature, otherwise I'd plonk the crap out of Morein.

soundhaspriority wrote:
"Fella" wrote in message
.. .
soundhaspriority wrote:

[snip]
I would have this suggestion to you: Stop seeing RAO as your turf or
whatever it is you may see it as that leads you to think you should (or
could, for that matter) restrict a given persons right to express this or
that opinion, no matter how obnoxious that set of opinions might be to
you. That kind of position is against the whole logic of usenet.


Fella,
I respectfully disagree with you.

How can you? You don't "respect" anyone or anything.

This thread was started by the
person I believe to be Dr. Richard Graham, not me. If usenet can tolerate an
anonymous shill, then it can certainly tolerate me.

I don't believe in surrendering a public resource to bad guys.

Newsflash Crazy Bob: You ARE the "bad guys". You're a pathological
liar, who's libelled innocent people on this group despite the fact
that they don't post here, spread false slander and rumour, deliberate
lying speculation that you pass off as "fact". Such as you stating
above that I am an "anonymous shill", when not only have you shown no
evidence to support that claim, there is more evidence that shows YOU
are the "shill" here.


To me, the issue is not about "tweaks."

No, it's about the ideas behind those "tweaks". Ideas which threaten
the entire IEEE and electronics manufacturing industry, (since they
imply that purchasing new audio equipment through habitual upgrades
every time a manufacturer comes out with a revised product, may not be
necessary). You, unlike me and most here, have financial interests in
the audio industry.

The issue is that I believe this person is trying to cheat the
public, by habituating readers of r.a.o. to an identity that hides his
financial relationship with PWB Electronics. To me, that is a cancer.

Uh-huh. But your opinion means nothing, since you are well established
as being a madman. That, plus the fact that you have NEVER, not ONCE
shown any incontrovertible evidence that proves I have any relationship
with PWB Electronics, or Rega, or Roksan, or any of the manufactuerers
I've mentioned in my messages. Not ONE. Every time I asked you for
proof, you laughed it off and ran away. Care to show proof now, in this
thread, that I am Richard Graham, I have a financial relationship with
PWB and am a paid shill? Didn't think so, liar.

Clearly, YOU are the "cancer" here. You and your evil lies against an
innocent man are a form of cancer.

I would like to evaluate the information you have mentioned, but I would
appreciate a link.

Yeah right. Pretend that you can be "reasoned with", and "convinced"
I'm not Graham if only you are shown "enough evidence". We both know
that you will never say otherwise, since you were never sincere in your
belief that I am Graham. Not after talking with the real Graham on the
phone at 3 am, anyway. That's just what makes you such an evil cancer
on this group, Bob.

Fella wrote:

And for the record, I see anonimity as a legitimate choice one has a
right to make, especially in the usenet. I think that these discussion
groups are a ground for the exchange of POV's, info, etc, between given
personalities, characters, etc, and *they* stay the same, *they* make up
the identity, regardless of what the handle claims about the identity.

Spot on, once again. That's why I said to Paul at the beginning of this
thread, Paul who insisted that the group will continue to believe I am
"Dr. Richard Graham" if I don't say "who I am", that my "identity" is
in every one of my posts. My point was just that: that it stays the
same no matter which alias I choose to post under. A person's first or
last names to me, are -completely unecessary info- on usenet, and I
rather wish we were all forced to post without them. (Already, Google
Groups seems to encourage people to post under aliases. I'm not even
sure how to enter a proper name there!)

Fella wrote:

soundhaspriority wrote:
"Fella" wrote in message
.. .

soundhaspriority wrote:

Of course you have the right to do so. But also you owe it to your own
sense of ethics to thoroughly investigate this issue before you take any
more concrete action against Richard Graham.

Somehow, I don't find the phrase "sense of ethics" and "Robert Morein"
to go together.

And Robert, don't be an
"unchangable", really, I mean no disresopect and all, but there are some
people on the usenet that just stick and stick to a position and never
even think of giving an inch, even if the coordinates of the intial
position they refuse the budge an inch from have changed and arm and a
leg in time, as it were. Arny comes to mind... Some of the more
religious fanatics I've slapped around at my time, comes to mind.

Some of the more religious fanatics that *I* have slapped around in my
time comes to mind as well. And yes, Arny's one of them. So again, what
you've said here is really worth saying, and I fully concur. It's the
reason why I find these groups, while they can provide some means of
venting frustrations or whatever, are ultimately boring experiences, on
an intellectual level. I mean the fact that I have rarely ever seen any
regular change their ideological positions. And I'm sorry but I've had
many legitimate conversations with Morein on the theories behind my
tweaks, and he never really impressed me as being wise enough to change
his wrongful positions on audio.

I know very well that I could sit here and type out debates for weeks,
months, even YEARS with Mad Morein, Powell, Steven Sullivan or Ludovic
on quantum mechanics and morphic resonance. I could bring out Rupert
Sheldrake and have HIM explain in person on RAO just why these three
"scientists" are dead wrong in their assumptions about the theories. It
wouldn't matter. They're dogmatists. They're in it simply for the
politics, not for the truth about audio. That's what you need to
understand. I already understand it because I saw it happening for
years with others. Engineers are the worst when it comes to dogmatic
ideology. Sander's an exception because he's a tweaker at heart, and
maybe even because he's a European, and they're "smarter" (more
progressive) than the Americans. But the two American audio engineers
here? Never! While they may differ on ABX rituals and details like
that, they both share the same fanatic devotion to their audio
religions. You have to remember that having them believe in a single
one of my tweaks, means that everything they thought they knew about
audio would have to be thrown out.

I do suggest you go down the same investigative path I went before you
make up your mind to do things irreversible, whatever they may be. And
yes, I am not just talking about the investigation of the SHP identity...

He'll investigate my ISP, Richard Graham's relationship with PWB, he'll
telephone Richard Graham's colleagues in London at NHS and Priory (as
he has admitted doing), he'll email Graham, he'll investigate one study
after another to support his claims that I'm a "shill" and a "Richard
Graham", but I'll tell you now, the last thing Bob will do is
investigate whether I really am Graham. It's not in Crazy Bob's
interest to do so, because he simply wants to rally against my audio
ideas, pointe finale. Because that's what threatens -him- and -his-
financial interests.

George M. Middius (the M is for "Moron") wrote:

Peka, I realize you've been coopted and your free will has been diminished,
but would it be such a hardship for you to explain how you learned what you
believe you know about the RAO troll?

Shovels, you spent a full 8 years here trolling this group every single
day of your wasted life, and you have another 8 years planned in the
works, so I hear. Who you calling a "RAO troll", you RAO troll? And how
has his "free will" has been diminished exactly? Was your "free will"
diminished after you tried my aspirin tweak?

Shovels flails wildly in all directions.

Having a Rotel amp is not an automatic membership to that class of hobbyist.
He probably inherited it from his daddy.

Not so, feckless one. You murdered my daddy, as you well know, when I was
but a wee little audiophile-to-be.





--
A day without Krooger is like a day without arsenic.

What's a puppy without a whole lotta love? ;-)

the next day, I find 16 messages and climbing, all about ME again.

Don't tell us you're complaining about being the center of attention. How
passive-aggressive can even a loony tune like you become, Shovie?

NOT RICHARD GRAHAM: 1 (Paul)
IS RICHARD GRAHAM: 1 (Robert)

You left out my vote:

hopped-up lunatic masquerading as the world's worst con artist: (1)






--
A day without Krooger is like a day without arsenic.

Shovie, you need some instruction in vote-counting.

The tally so far is:
NOT RICHARD GRAHAM: 2 (Paul, Walt)
IS RICHARD GRAHAM: 1 (Robert)

hopped-up lunatic masquerading as the world's worst con artist: (1)




--
A day without Krooger is like a day without arsenic.